- Cadherin-17 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-88239
- Human
- Western Blot, Simple Western, Immunohistochemistry, Immunohistochemistry-Paraffin
- Unconjugated
- PBS (pH 7.2) and 40% Glycerol
- CDH16, HPT-1, HPT1
- Cadherin-17
- This antibody was developed against Recombinant Protein corresponding to amino acids: INNVMYFQIN NKTGAISLTR EGSQELNPAK NPSYNLVISV KDMGGQSENS FSDTTSVDII VTENIWKAPK PVEMVENSTD P
- 0.1 ml (also 25ul)
- Rabbit
- cadherin 17
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Cancer
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
INNVMYFQINNKTGAISLTREGSQELNPAKNPSYNLVISVKDMGGQSENSFSDTTSVDIIVTENIWKAPKPVEMVENSTDP
Specifications/Features
Available conjugates: Unconjugated